SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093ID70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093ID70
Domain Number 1 Region: 3-264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-78
Family Protein kinases, catalytic subunit 0.0000155
Further Details:      
 
Domain Number 2 Region: 274-351
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000506
Family Regulator of G-protein signaling, RGS 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093ID70
Sequence length 960
Comment (tr|A0A093ID70|A0A093ID70_EURHL) Mitogen-activated protein kinase kinase kinase 9 {ECO:0000313|EMBL:KFV99532.1} KW=Complete proteome; Reference proteome OX=54383 OS=Eurypyga helias (Sunbittern). GN=N326_03492 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Eurypygidae; Eurypyga.
Sequence
NFSELVLEEIIGIGGFGKVYRAVWVGDEVAVKAARYDPDEDISQTIENVRQEAKLFAMLK
HPNIIALRGVCLKEPNLCLIMEFARGGSLNRVLSGKRIPPDILVNWAVQIARGMNYLHEE
AIVPIIHRDLKSSNILILEKVENGDLSNKILKITDFGLAREWHKTTKMSAAGTYAWMAPE
VIRSSMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALPIPSTCPEPFA
KLMEDCWNPDPHSRPSFATILDHLTAIEESGFFEMPKDSFHSLQEDWKQEIQEMFDQLRA
KEKELRTWEEELTRAAVEQKNHEELLRRREQELAEREIDILERELNIIIHQLCQEKPRVK
KRMGKFKRNRLKLKDGNHISLPSDFQHKFTVQASPTMDKRKSLISSCSSPPASPTIIPRL
RAIQLTQTWGRSSVLPKEEGEEEEKRGQKKKGRTWGPSSLCHKELGAGEDRTPEMAFLTV
VVAFLCNLQTNLKALVEGYKQWSSSAPNLGKIQRTALAFPGFTSLAEMDDEDSECLNGEG
KVHPSPGHNQSYLCIPFQKNEDWDGPSSDANEESTPVNSATSTPQLTPTNSLKCSGSHHK
RCEVALLGCGAVLAAAGLGFDLLEAGKCQLLIEEEPEAPKEEKKKRDSIFQRAGRPRRST
SPPSRKIFKKEDPMLLLGEPSTSLTLLSLSSISECNSTRSLLRSDSDEIVVYEMPVSPVT
VKAPLPAITNPLVNVQIERFKQDPNQSLTPTHVTLSSHTQQSGHRRTPSDGAIKGSGLVV
NGCPTSGCPSSSCLTGALGAGVLKTPSPSRDPNEVPRLPDPNLVFPPTPRRWNAQQDPTL
ERPKTLEFLPRPRPAASRQRLDPWWFVSPSNAKGESSANSSSTDTPSNLDSCFASSSSTV
EERPGLPALLPLQVGLPVEERTLLDIDAEGQSQDSTIPLCRSELNTHKAAAYELKQEFWS
Download sequence
Identical sequences A0A093ID70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]