SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093IE68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093IE68
Domain Number 1 Region: 246-375
Classification Level Classification E-value
Superfamily ApaG-like 7.98e-40
Family ApaG-like 0.00024
Further Details:      
 
Domain Number 2 Region: 65-232
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.14e-17
Family SMI1/KNR4-like 0.01
Further Details:      
 
Domain Number 3 Region: 1-50
Classification Level Classification E-value
Superfamily F-box domain 0.0000102
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093IE68
Sequence length 420
Comment (tr|A0A093IE68|A0A093IE68_DRYPU) F-box only protein 3 {ECO:0000313|EMBL:KFV65046.1} KW=Complete proteome; Reference proteome OX=118200 OS=Dryobates pubescens (Downy woodpecker) (Picoides pubescens). GN=N307_15012 OC=Coelurosauria; Aves; Neognathae; Piciformes; Picidae; Picoides.
Sequence
SCCYLSRRLNQLSNHDPLWRRHCKKYWLISEEEKCRRDQSWKALFISTYRDLGRYIQYYA
TLKKAWDDLEKYLGQRCPRMIGSLKESVQEEDLDAVEAQIGCQLPDDYRCSFRIHNGQKL
VVPGLMGSMALSNHYRSEDLLDIDTAAGGFQQRLGLKQCLPLTFCIHTGLSQYMALESVE
GRNKYEIFYQCPDQMARNPSAIDMFITGTSYLEWFTSYVNKVVTGGYPIIRDQIFRYVHD
KECVATTEDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRII
NARGDVDEVQGPGVVGEFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFRCLYYKEKFFNV
TIPRFHMVCPTFKVSTARMETSHNEYAVDEDEDSTDTDEYEERRRVLDIPAPVGRCPRHT
Download sequence
Identical sequences A0A093IE68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]