SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093IFA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093IFA0
Domain Number 1 Region: 203-326
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.47e-25
Family Regulator of G-protein signaling, RGS 0.002
Further Details:      
 
Domain Number 2 Region: 415-551
Classification Level Classification E-value
Superfamily PX domain 2.09e-23
Family PX domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093IFA0
Sequence length 759
Comment (tr|A0A093IFA0|A0A093IFA0_EURHL) Sorting nexin-25 {ECO:0000313|EMBL:KFV98271.1} KW=Complete proteome; Reference proteome OX=54383 OS=Eurypyga helias (Sunbittern). GN=N326_03557 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Eurypygidae; Eurypyga.
Sequence
RQEDPPRPFLLHPCLRSTDEEVRFLQKCSQILVYCLLPSKDVQSVSLRIVLAEILATKVL
KPVVELLSDPDYINRMLLSQLEYREQMNEHQKKDYTYAPSYEEFIKLINSSSDVEFLKQL
RYQIVVEIVQATTISNIPQVKRQKDSKGKETAAMKADLLRARNVKRYINQLTVAKKQCEK
RIRLLGGPAYDQQEDGISDEGDGPQSQKILQFEEILANPSYREHFRIYMERMDKMALIGL
WESVEYLKSANKAEIPQLVSEIYQNFFVESREIPVEKSLYKEIQQSLVGNKGIEVFYRIQ
ADVYETLKDRYYPSFIVSDLYERSVKKEEERSSAQLTAEDKDEVSQGCEEAPEECSTGIN
EQASYAVNKLRQLNDKLEYKKQALNSICNSPKPDKKIVSKLKDEITLMEREHSDLQLHIA
RTDWWCENLGMWKAFIVSGEVLEENGEQVPCYSVMVSLQEVGGAETKNWTVPRKLSEFQN
LHRKLSECFPSLKKVQLPSLSKLPFKSVDQKFMEKSKNQLNNFLQKLLSDERLCQSEALY
AFLSPSPEHLKVIDVQGKKSSFSLSSFLERLPGDLFSHQEEETEEDSDLSDYGDEVDGKR
DSLAEPCFMLIGEIFELRGMFKWVRKTLIALVQVTFGRTINKQIRDTVHWMFSEPMLVYY
IAVFRDAFWPNGKLAPPPRAKSDEQKQETKQRAQQKLLENIPDTLQSLVGQQNARHGVVK
VFNALQERKANKHLLYVLLELLLTELCPELRAHVEQLNA
Download sequence
Identical sequences A0A093IFA0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]