SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093IHN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093IHN4
Domain Number 1 Region: 14-75
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000903
Family HLH, helix-loop-helix DNA-binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 85-129
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000392
Family Hairy Orange domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093IHN4
Sequence length 227
Comment (tr|A0A093IHN4|A0A093IHN4_FULGA) Transcription cofactor HES-6 {ECO:0000313|EMBL:KFW01143.1} KW=Complete proteome; Reference proteome OX=30455 OS=Fulmarus glacialis (Northern fulmar). GN=N327_09458 OC=Fulmarus.
Sequence
MTAAATAGGTHKLTSTKEERKLRKPLIERKRRERINNCLDQLKETVVGAFHLDQSKLEKA
DILEMTVKHLQNIQSSKLMADSKVGLEAQQRYSTGYIQCMHEVHNLLLTCEWMDKTLGAR
LLNHLLKSLPRSGEDTCKAALRSSSPSQQPLLTPKSPLSPKGSTRGTNPSQERFHPAENK
QASKNSFQLPSLSVFSQVDAAPPRQVLQPNFSHNNPRMGSLGMWRPW
Download sequence
Identical sequences A0A093IHN4
XP_009571907.1.87690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]