SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093IMP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093IMP1
Domain Number 1 Region: 145-399
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 1.96e-70
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.0000928
Further Details:      
 
Domain Number 2 Region: 2-119
Classification Level Classification E-value
Superfamily SNARE-like 6.41e-31
Family Clathrin coat assembly domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093IMP1
Sequence length 400
Comment (tr|A0A093IMP1|A0A093IMP1_FULGA) AP-3 complex subunit mu-1 {ECO:0000313|EMBL:KFW00019.1} KW=Complete proteome; Reference proteome OX=30455 OS=Fulmarus glacialis (Northern fulmar). GN=N327_01673 OC=Fulmarus.
Sequence
KSVVSQSVCDYFFEAQEKAIDVENVPPVISTPHHYLISIYRDKIFFVSVIQTEVPPLFVI
EFLHRVADTFQDYFGECSETAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTIL
RSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVIEEIDAIIDKSGSTVFA
EIQGVIDSCISRSFSFFHALCHYLQNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFR
LISYRVSSQNLVAIPVYVKHMISFKENSSSGRFDVTIGPKQNMGKTVEGVVMTVHMPKAV
LNMNLTATQGSYTFDPVTKVLTWDVGKITPQKLPNLKGIVNLQSGAPKPEENPSLNIQFK
IQQLAISGLKVNRLDMYGEKYKPFKGVKYITKAGKFQVRT
Download sequence
Identical sequences A0A093IMP1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]