SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093JLD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093JLD3
Domain Number 1 Region: 258-403
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.77e-24
Family Regulator of G-protein signaling, RGS 0.003
Further Details:      
 
Domain Number 2 Region: 493-621
Classification Level Classification E-value
Superfamily PX domain 1.57e-21
Family PX domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093JLD3
Sequence length 876
Comment (tr|A0A093JLD3|A0A093JLD3_FULGA) Sorting nexin-14 {ECO:0000313|EMBL:KFW11709.1} KW=Complete proteome; Reference proteome OX=30455 OS=Fulmarus glacialis (Northern fulmar). GN=N327_11654 OC=Fulmarus.
Sequence
PDSLLPNILFTIKYKPKQLELPELFPHGHSCAVCGKVKCKRHRPTLLLENYQPWLDLKVP
SKVDASLSEVLELVLENFIYPWYRNITDDESSVDELRGTLRFFASVLVRRIHKVDIPTVV
TKKMLKAAMKHIEVIAKARQKVKNAEFLQQAALEEYGPELHVALRSRRDELHYLRKLTEL
LFPYILPPKSTECRSLALLIREILPGSVFLPSMDFLADPDTVNHLLLIFIDDSPPEKATE
PTSSLVPFLHKFAEPRNKKPSVLKLELKEIRDQQDLLFRFMNFLKQEGAVHVLQFCLTVE
EFNDRILRPELSDTEKMSLHEEVQKIYKTYCLDESIDKIRFDPFIVEEIQRIAEGPYMDV
VKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRHLLRGAESPTRNSKFNRSSLSLDD
FRTTQKRGESFGISRIGNKIKGVFKSSAMEGAMLPNYNLNEGEDDFIEEGVMVMEDDSPE
EAISTPNTPRNLAAWKISIPYVDFFDDPSLERKDRKERIPVFCIDVERNDRRAVGHEPEH
WSVYRRYLEFYVLESKLTEFHGTFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQH
PELSNSQLLADFLSPNGGETQFLDKMLPDVNLGKIIKSVPGKLMKEKGQHLEPFIMNFIN
SCESPKPKPSRPELTILSPTSENNKKLFNDLFKNNANRSENTERRQNQNYFMEMMTVEGV
YDYLMYIGRVVFRIPDWLHHLLMGGRILFKNTLELYTDYYLHYKLEQLFQEHRLVSLITL
LRDAVFCENTEPRSLQDKQKRAKQTFEEMMRYIPDLIGKCIGEEAKYEGIRLLFDGLQQP
VLNKQLTYVLLDIGIQELFPELSKGPKEASSVSCWM
Download sequence
Identical sequences A0A093JLD3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]