SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093KLV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093KLV8
Domain Number 1 Region: 368-514
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.15e-25
Family Regulator of G-protein signaling, RGS 0.0025
Further Details:      
 
Domain Number 2 Region: 556-671
Classification Level Classification E-value
Superfamily PX domain 2.09e-24
Family PX domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093KLV8
Sequence length 995
Comment (tr|A0A093KLV8|A0A093KLV8_EURHL) Sorting nexin-13 {ECO:0000313|EMBL:KFV98650.1} KW=Complete proteome; Reference proteome OX=54383 OS=Eurypyga helias (Sunbittern). GN=N326_03321 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Eurypygidae; Eurypyga.
Sequence
QTSLSIWGWGSLGLVLFLLTFGPFAIFYFAFYILCFVGGGFVVTLLFGKSNSEKYLEQCE
HSFLPCTSVGIPKCIEEMKREARPIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWYYTL
SDDESFLLEIRQALQYALVQFSARSKETDWQPYFTTRLVDDFGTHLRVFRKAQQRIAEKG
DQMKGQAEELVDTFFEVEVEMEKEVCRDLVCTSPKDEEGFLRDLCEVLLYILLPPGDFQN
KIMRYFVREILSRGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNIGEL
EAVKDKASEELQYLRSLDTAGDDINTIKNQINSLLYVIKVCDSRIQRLQSGKEIDTVKLA
ANFGKLCTVPLDHILVDNVALQFFIDYMQQTGGQAHLFFWMTVEGYRVTAQQQLEVLQSR
QKDGKHQTNQTKGLLRAAAFGVYEQYLSEKASPRVNIDDNLVAKLAETLNHEDPTPEIFD
DIQRKVYELMLRDERFYPSFKQNALYVRMLAELDMLKDPSFRGSDDGEGESFNGSPTGSI
NLSLDDLSNVPSDEAVQLHAYISDTGVCNDHGKTYALYAITVHRRNPNSEETWKTYRRYS
DFHDFHMRITEQFENLANILKLPGKKTFNNMDREFLEKRKKDLNAYLQLLLNPEMMKASP
ALAHYVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGMTKMSD
NMGKMSERLGQDIKQSFFKVPPLIQKTYSDPDHCRVAAPIDDNVDDNIPLRVMLLLMDEV
FDLKERNQWLRRNIKNLLQQLIRATYGDTINRYCFSYIEQSCECVYHFCKHTRFGCRVVC
RKIVDHVDWMTSPEQVADAVKRFRDAFWPNGILAEAVPRRDKAIRMRTRVAGKTKLLEVM
PDELKHIIGAETTRKGILRVFEMFQHTQLNKRMVYVFLERFLETLFPQNKFHELFNKLHS
RSKQMQRYKQRLHCTQAPSLQKSLLVSHITLLMHL
Download sequence
Identical sequences A0A093KLV8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]