SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093KNB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093KNB6
Domain Number 1 Region: 38-178
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.23e-28
Family CRAL/TRIO domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093KNB6
Sequence length 222
Comment (tr|A0A093KNB6|A0A093KNB6_EURHL) Rho GTPase-activating protein 8 {ECO:0000313|EMBL:KFV99110.1} KW=Complete proteome; Reference proteome OX=54383 OS=Eurypyga helias (Sunbittern). GN=N326_02504 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Eurypygidae; Eurypyga.
Sequence
LAPSELQKDEAEDTPSEQGETYIPPLLEDPELNINHPYYDVARHGIIQLAGDDNSGRKVI
TFSCCRMPPSHQLNHTRLLEYLKYTLDQYVENDYTVVYFHYGLKSLNKPSLKWLQTAYKE
FDRKYKKNLKALYVVHPTNFIKILWNIFKPLISHKFGKKVTYLNYLSDLREHLKYDQLNI
PQEVIRHDENLRGKQKGKLPPVVKVPPPRPPLPTQQFGVSLQ
Download sequence
Identical sequences A0A093KNB6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]