SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093LPW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093LPW1
Domain Number 1 Region: 411-518
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000162
Family Regulator of G-protein signaling, RGS 0.007
Further Details:      
 
Domain Number 2 Region: 109-226
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000162
Family Regulator of G-protein signaling, RGS 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093LPW1
Sequence length 531
Comment (tr|A0A093LPW1|A0A093LPW1_EURHL) Regulator of G-protein signaling protein-like {ECO:0000313|EMBL:KFW10806.1} KW=Complete proteome; Reference proteome OX=54383 OS=Eurypyga helias (Sunbittern). GN=N326_06969 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Eurypygidae; Eurypyga.
Sequence
TIASTDMGLLLRDDVFVDFFNTFLNLPVFGQTPIYITSMGRWELWPELPSQLVRKSPCKE
ALLAWLEKHRLPHFCKSTLCLHLVLCQKLLGFIRSGEAAKLLNWQSADWWLLEKCISGSQ
GMWRFRAFLQGMAGEELTDFWLITERLLGLDESDEGQRDLYLSLLHRLKATHLREGSSVI
TLCRTLVGSLLKARHVQPISTRREILSKMQEQALFVIQSYWLPKFFIHCKMYMEEEELCR
PVLQEYRERLFQARSQEPSGFLENLFTMHIKGSQGFSGPYCSKKAKAEIWTLVKEGKDTQ
EMKMPSFWVQPEGQLGPAGSTKESRAHKDALGSIPQQSEHPASTAFGGKGGETSPKRPRQ
VLPLEDLCEEQVLPHLRSSAPLVRLPSLKKPVKTLSFLPWALSAETCAGRPFRDFLMCQD
RSVETRLLDLWHDLEEFLPVALDPSRENSFFLRRLIGEKICKTYLEEGIIQQLPLETRTL
RSLRNHLMSGEFSPWIFRAQKEICKVLCCFYEEFLADDDRTFLRFMVKGMN
Download sequence
Identical sequences A0A093LPW1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]