SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093N9X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093N9X5
Domain Number 1 Region: 175-280
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.5e-37
Family Transforming growth factor (TGF)-beta 0.0000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093N9X5
Sequence length 281
Comment (tr|A0A093N9X5|A0A093N9X5_PYGAD) Bone morphogenetic protein 7 {ECO:0000313|EMBL:KFW60991.1} KW=Complete proteome; Reference proteome OX=9238 OS=Pygoscelis adeliae (Adelie penguin). GN=AS28_04473 OC=Pygoscelis.
Sequence
VHVDQYRFSFDISAMEKGERMLKAELRVFKLKRTHVSRRSDVKHFCKVEVYELMESGSKP
QKKHLVASRLLSLYTEGWEVFNVTQTVSKWVGNSSSNRGFLITTTHVFNNRIEHNLVKFA
KSQGALQESRNALLVLFTNSNKRRSSSFLPSSTSKFTPQQQLRPRAAATPSAKSQVTACH
RRELYVDFRAIGWSGWIIYPSGYNAFYCRGSCLFPLGESLNATNHATVQSIVHTLKLSQD
VSTPCCVPDELKSLNLLYFDDKENVVLKNYKDMVATRCGCH
Download sequence
Identical sequences A0A093N9X5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]