SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093NQD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093NQD7
Domain Number 1 Region: 18-129
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-37
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 237-351
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-30
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 3 Region: 133-215
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.09e-23
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093NQD7
Sequence length 355
Comment (tr|A0A093NQD7|A0A093NQD7_PYGAD) CUB domain-containing protein 2 {ECO:0000313|EMBL:KFW64170.1} KW=Complete proteome; Reference proteome OX=9238 OS=Pygoscelis adeliae (Adelie penguin). GN=AS28_04123 OC=Pygoscelis.
Sequence
SPGKGTSHPPLCPPGIKCGGVLSAPSGNFSSPNFPGLYPYETECTWLIVVAEGSSVLLSF
SHFELEYHAACAYDYLQVYNGAARDQGNLLGTFCGHSPPPPFSSAWHVMAIVFRSDRHVA
KRGFAAAYQKDACGGQLTGLSGEITSPRYPESYPNEAECRWSIGGAGGPLTLVFTDFQVE
GGQGCTFDYVALFDGPTTAAPRLGRYCGSARPPRTVVRVVGWFALIFSFPFVPRAGECQE
VFTTIKGNLSSPRYPNFYPNNLKCQWSIRLPLRYRVKVFFLDMELEGRSSLTGSCDYDHL
AAFDGGAENGSLLGRWCGRESLAPIPSRSNQLLLVLHTDRNTAKRGFSIAYVGGK
Download sequence
Identical sequences A0A093NQD7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]