SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093NQR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093NQR0
Domain Number 1 Region: 119-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-34
Family cAMP-binding domain 0.000000903
Further Details:      
 
Domain Number 2 Region: 248-372
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.63e-32
Family cAMP-binding domain 0.000000788
Further Details:      
 
Domain Number 3 Region: 15-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.62e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093NQR0
Sequence length 381
Comment (tr|A0A093NQR0|A0A093NQR0_PYGAD) cAMP-dependent protein kinase type I-beta regulatory subunit {ECO:0000313|EMBL:KFW64335.1} KW=Complete proteome; Reference proteome OX=9238 OS=Pygoscelis adeliae (Adelie penguin). GN=AS28_05856 OC=Pygoscelis.
Sequence
MAAASSCNVEEDESLKGCELYVQKHNIQQILKECIVNLCIAKPDRPMKFLREHFEKLEKE
ECKQILARQKSSSQSDSHDDEISPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQG
EVDVYVNGEWVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTA
SVLQRRSDNEEYIEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSEILKRNIQRYNSFISLTV
Download sequence
Identical sequences A0A087RFU9 A0A093E5A7 A0A093NQR0 R0LH91
ENSAPLP00000007523 XP_005020117.1.99704 XP_009284648.1.47732 XP_009318279.1.49731 XP_009976804.1.11325 XP_010294577.1.48707 XP_013032554.1.65836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]