SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093NXY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093NXY0
Domain Number 1 Region: 238-368
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.28e-44
Family Regulator of G-protein signaling, RGS 0.000000217
Further Details:      
 
Domain Number 2 Region: 1-64
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.16e-16
Family DEP domain 0.023
Further Details:      
 
Domain Number 3 Region: 173-229
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000000235
Family Transducin (heterotrimeric G protein), gamma chain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093NXY0
Sequence length 379
Comment (tr|A0A093NXY0|A0A093NXY0_PYGAD) Regulator of G-protein signaling 9 {ECO:0000313|EMBL:KFW66840.1} KW=Complete proteome; Reference proteome OX=9238 OS=Pygoscelis adeliae (Adelie penguin). GN=AS28_13794 OC=Pygoscelis.
Sequence
TGNDILQWILQRLQITEEEALHLGDLFVKYGYIYPLQEPKNLTLKTDGSLYRFQTPYFWP
TQSWPADDTDYAIYLAKKNIKRKGILEEYEKEHYNMLNQKINYKWDFVIMQAKEQYKAGK
ERKKADRYALDCQERAYWLVNRTPPGMLDVLEYGLDRVTDPNENKVNQKKTMTVYRREIM
YYQQAIMKPRVKSSVSVGGLVKYSEQFLSSDPILSGCLPGNPWITDDPEFWDLNAKLVEI
PTRMRVERWAFNFSELIRDPKGRQNFQLFLRKEFSGENLSFWEACEDLKYGDQSKVKEKA
EEIYKLFLAPGARRWINIDGTTMGITVKGLKHPHRYVLDAAQTHIYMLMKKDSYGRYLKS
PVYKEMLAKAVVPQEAVKK
Download sequence
Identical sequences A0A093NXY0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]