SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093P235 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093P235
Domain Number 1 Region: 1493-1667
Classification Level Classification E-value
Superfamily Fibronectin type III 1.25e-29
Family Fibronectin type III 0.0000845
Further Details:      
 
Domain Number 2 Region: 862-1028
Classification Level Classification E-value
Superfamily Fibronectin type III 1.89e-23
Family Fibronectin type III 0.00085
Further Details:      
 
Domain Number 3 Region: 1224-1393
Classification Level Classification E-value
Superfamily Fibronectin type III 6.36e-23
Family Fibronectin type III 0.0000274
Further Details:      
 
Domain Number 4 Region: 1678-1848
Classification Level Classification E-value
Superfamily Fibronectin type III 1.97e-22
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 5 Region: 679-844
Classification Level Classification E-value
Superfamily Fibronectin type III 2.43e-22
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 6 Region: 1859-2027
Classification Level Classification E-value
Superfamily Fibronectin type III 4.74e-21
Family Fibronectin type III 0.0000132
Further Details:      
 
Domain Number 7 Region: 362-417
Classification Level Classification E-value
Superfamily Kringle-like 5.14e-21
Family Fibronectin type II module 0.0000556
Further Details:      
 
Domain Number 8 Region: 1401-1490
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-20
Family Fibronectin type III 0.00000709
Further Details:      
 
Domain Number 9 Region: 301-357
Classification Level Classification E-value
Superfamily Kringle-like 4e-20
Family Fibronectin type II module 0.00011
Further Details:      
 
Domain Number 10 Region: 1045-1213
Classification Level Classification E-value
Superfamily Fibronectin type III 5.08e-17
Family Fibronectin type III 0.0000189
Further Details:      
 
Domain Number 11 Region: 568-654
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000101
Family Fibronectin type III 0.0000101
Further Details:      
 
Domain Number 12 Region: 511-557
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000116
Family Fibronectin type I module 0.0017
Further Details:      
 
Domain Number 13 Region: 2293-2336
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000301
Family Fibronectin type I module 0.0013
Further Details:      
 
Domain Number 14 Region: 469-513
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000471
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 15 Region: 181-225
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000994
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 16 Region: 425-465
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000105
Family Fibronectin type I module 0.0022
Further Details:      
 
Domain Number 17 Region: 2248-2291
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000012
Family Fibronectin type I module 0.0035
Further Details:      
 
Domain Number 18 Region: 44-89
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000262
Family Fibronectin type I module 0.00014
Further Details:      
 
Domain Number 19 Region: 134-180
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000484
Family Fibronectin type I module 0.00019
Further Details:      
 
Domain Number 20 Region: 2-41
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000222
Family Fibronectin type I module 0.00043
Further Details:      
 
Domain Number 21 Region: 92-132
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000393
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 22 Region: 2336-2377
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000236
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 23 Region: 260-298
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000929
Family Fibronectin type I module 0.00053
Further Details:      
 
Domain Number 24 Region: 2162-2227
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000667
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093P235
Sequence length 2431
Comment (tr|A0A093P235|A0A093P235_PYGAD) Fibronectin {ECO:0000313|EMBL:KFW71063.1} KW=Complete proteome; Reference proteome OX=9238 OS=Pygoscelis adeliae (Adelie penguin). GN=AS28_13418 OC=Pygoscelis.
Sequence
ETCFDNGRYYQINEQWERIYLGNTLVCTCYGGSRGFNCESKPEPEETCFDKYTGSTYRVG
ETYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVC
LGNGKGEWTCKPVAERCYDNTAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRN
RCNDHDTKTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSLHTTSTGSGSPSFT
NVQTALYQPQPQQPQPQPYGQCITDNGVVYSVGMQWLKTQGSQQMLCTCLGNGVSCQEIA
VTQTYGGNSDGEACVLPFTYDGRTFYSCTTEGRTDGHLWCSTTSNFEQDRRYSFCTEQNI
LVQTRGGNSNGALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTENYDADQKFGFCPMAAH
EEICTTNDGVMYRVGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDGITYD
VNQTFHKRHDEGHMLNCTCFGQGRGRWKCDPVDQCQDSETRTFYQIGDSWEKYVHGVRYQ
CYCYGRGIGEWHCQPLQTYPGSTGPVQVIITESTNQPNSHPIQWNAPERSHITKYILRWR
PKNSGRQWKEATIPGYQNSYTISGLKPGVIYEGQLISVQRYGHKEVTRFDFTTTSTTAVT
SNTVSGETTLLPPMVATSESVTEITANSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLD
LPSTATSVNIPDLLPGRKYIVNVYQISEEGEQNLILSTSQTTAPDAPPDHTVESVDDTSI
VISWSRPQAPITGYRIIYTPSVEGSSTELNLPDTATSVTLSDLMPGVQYNISIYAVEENQ
ESTPIFIQQETTGVPRTDEVPSPKDLQFVEVSDIKITIMWTPPQSQVSGYRVEVIPVNRP
GQHGQRLPITRSSFAEVVDLLPGTTYLFKIFAVSQGRESKPLTGEQTTKLDAPTNLRFLN
TTEHSVLVLWTRPRAVITGYRLTAGPTRGGQPRTYNVGPSATKYLLRNLQPGTEYTVYLV
AVKDDLQSTRETGVFTTYQPVGSVPPFNTEVTETSIVITWTPAPRIGFKLGVRPSQGGEA
PREVISDSGSIVISGLTPGVEYTYSLTVLMDGQERETPIIRRVTTPLSPPTNLRLEPNPD
TGILVVSWDRSTTPGISGYRVTTAATNGQQGSTLEEVVGADQTTCTFENLNPGVEYNVSV
YSVKDDQESIPISETITQEVPQLTDLSFVDITDSSIGLRWTPLNASTIIGYRITVVAAGE
SVPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFT
NVAPDTMRVTWTAPTSIVLTSFLVRYSPVKKDEDVAELTISPSDNMVILTNLLPGTEYLV
RVYSVSEQHESAPLSGIQKTGLDSPTGLDFSDITANSFTVHWIAPRATITGYKIRHHPEH
GAGRHKEDRVPPSRNSITLTNLLPGTEYVVSIIAINGREESVPLVGQQTTVSDVPRDLEV
TPTSPTSLVISWDAPAVTVRYYRITYGETGGSSPVQEFTVPGTMSTATITGLKPGVDYTI
TVYAVTGRGDSPASSKPVTVTYKTEIDTPSQMQVTDVQDNSISIRWLPSASPVTGYRVTA
VPKKGHGPTKTKNVPADQTQVTIEGLQPTVEYMVSVYAQNQNGESLPLVETAVTNIDRPK
GLTFTEVDVDSIKIAWESPQGQVTRYRVTYSSPEDGIHELLPAPGGEEDTAELHGLRPGS
EYTINIVAIYDDMESLPLTGTQSTAIPPPTNLKFTQVTPTSLTVNWNAPNVRLTGYRVRV
NPKEKTGPMKEINLSPDSTSAVVSGLMVATKYEVSVYALKDSLTSRPAQGVVTTLENVSP
PRRARVTDATETTITITWRTKTETITGFQVDAVPASGQNPIQRTISPDVRTYTITGLQPG
NDYKIYLYTLNENARSSPVVIDASTAIDAPSNLRFLTTTSNSLLATWQPPRAKITGYIIR
YEKPGSPAKEVLPRPRPSTTEATITGLEPGTEYIIYIIAVKNNQKSEPLVGRKRTDELPT
LITRPHPNQPDILDVPSIDEGTPYLTNNRYDNGNGIQLPGTSGHPQTIGHQGQQVFFEEH
GYRRPVPTTATPLRPGSRRQPPNVDEAIEIPGYQVPIIVEPSYPHSRGPRRNDSTGQEAL
SQTTISWRPLLESSEYIISCQPVSQDEDTLQFRVPGTSSSATLTGLTRGATYNIIVEALK
DHRRQKVLEEVVTVGNTVSEGLNQPADDTCFDTYTGSFYSIGEEWERLSETGFKLWCQCL
GFGSGHFRCDSSKWCHDSGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCEPHETTCY
DDGKMYQVGEQWQKEYFGAICSCTCYGGQQGWRCDNCRRPSVEVAPEGSAGHTYTQFTQR
YHQATNTNVNCPIECFMPLDVQADTQHPRGK
Download sequence
Identical sequences A0A093P235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]