SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093PH04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093PH04
Domain Number 1 Region: 300-445
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.62e-24
Family Regulator of G-protein signaling, RGS 0.003
Further Details:      
 
Domain Number 2 Region: 535-663
Classification Level Classification E-value
Superfamily PX domain 1.7e-21
Family PX domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093PH04
Sequence length 918
Comment (tr|A0A093PH04|A0A093PH04_PYGAD) Sorting nexin-14 {ECO:0000313|EMBL:KFW73530.1} KW=Complete proteome; Reference proteome OX=9238 OS=Pygoscelis adeliae (Adelie penguin). GN=AS28_12072 OC=Pygoscelis.
Sequence
QLFCCLLLGLGAATLLLNRYLHVLMIFWSFVAGVVTFYCSLGPDSLLPNILFTIKYKPKQ
LELPELFPHGHSCAVCGKVKCKRHRPTLLLENYQPWLDLKVPSKVDASLSEVLELVLENF
IYPWYRNITDDESSVDELRGTLRFFASVLVRRIHKVDIPTVVTKKMLKAAMKHIEVIAKA
RQKVKNAEFLQQAALEEYGPELHVALRSRRDELHYLRKLTELLFPYILPPKSTECRSLAL
LIREILPGSVFLPSMDFLADPDTVNHLLLIFIDDSPPEKATEPTSSLVPFLQKFAEPRNK
KPSVLKLELKEIRDQQDLLFRFMNFLKQEGAVHVLQFCLTVEEFNDRILRPELSDTEKMS
LHEEVQKIYKTYCLDESIDKIRFDPFIVEEIQRIAEGPYVDVVKLQTMRCLFEAYEHVLS
LLENVFTPMFCHSDEYFRHLLRGAESPTRNSKFNRSSLSLDDFRTTQKRGESFGISKIGN
KIKGVFKSSAMEGAMLPNYNLNEGEDDFIEEGVMVMEDDSPEEAVSTPNTPRNLAAWKIS
IPYVDFFDDPSLERKDRKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLT
EFHGTFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPNGG
ETQFLDKMLPDVNLGKIIKSVPGKLMKEKGQHLEPFIMNFINSCESPKPKPSRPELTILS
PTSENNKKLFNDLFKNNANRSENTERRQNQNYFMEMMTVEGVYDYLMYVGRVVFRIPDWL
HHLLMGGRILFKNTLELYTDYYLHYKLEQLFQEHRLVSLITLLRDAVFCENTEPRALQDK
QKRAKQTFEEMMRYIPDLIGKCIGEEAKYEGIRLLFDGMQQPVLNKQLTYVLLDIGIQEL
FPELSKGPKEASSVSCWM
Download sequence
Identical sequences A0A093PH04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]