SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093PS64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093PS64
Domain Number 1 Region: 267-397
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.89e-44
Family Regulator of G-protein signaling, RGS 0.000000225
Further Details:      
 
Domain Number 2 Region: 2-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.39e-24
Family DEP domain 0.01
Further Details:      
 
Domain Number 3 Region: 201-258
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000000101
Family Transducin (heterotrimeric G protein), gamma chain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093PS64
Sequence length 626
Comment (tr|A0A093PS64|A0A093PS64_9PASS) Regulator of G-protein signaling 9 {ECO:0000313|EMBL:KFW79261.1} KW=Complete proteome; Reference proteome OX=328815 OS=Manacus vitellinus (golden-collared manakin). GN=N305_07969 OC=Coelurosauria; Aves; Neognathae; Passeriformes; Pipridae; Manacus.
Sequence
QIEALMMEMQSPDTGIKTQTQTVMVASIPHAVTGNDILQWILQRLQITAEEALHLGDLFV
KYGYIYPLQEPKNLTLKADGSLYRFQTPYFWPVQGWAADDTDYAIYLAKKNIKRKGILEE
YEKEHYNMLNQKINYKWDFVIMQAKEQYKAGKERKKEDRYALDCQERAYWLVNRTPPGMQ
DVLEYGVDRVTDPNENKKNTMEAYRREIMYYQQAIGKTRVKSSVSLGGIVKYSEQFLSND
PILSGCLPSNPWITDDPEFWDLNAKLVEVPTRMRVERWAFNFSELIRDPKGRQNFQLFLK
KEFSGENLSFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGARRWINIDGTTMGITVKGLK
HPHRYVLDAAQTHIYMLMKKDSYGRYLKSPIYKEMLAKAVVPQETVKKRQVKLAVIVGTG
LFGRRHLRSSPSPIILRQQEEEAKAREAAATVDITQPCHLASQAPRPAAHAGTSTPPLPT
LPPTLPDPLALPQGTACPSPTSLALDSSGTMGTLQDPRGAGPGPFPSGSRRSLGRFLRRG
CWTSPPSPRWSAGQYCPGTWASSPPPPLLFVISQSFFQVRADVPSKSRVCPEGSKEGEDG
HPRARKDSTKELICPWETPTEEGRAG
Download sequence
Identical sequences A0A093PS64

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]