SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093PSE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093PSE9
Domain Number 1 Region: 163-404
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 7.19e-55
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0029
Further Details:      
 
Domain Number 2 Region: 1-162
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 3.27e-44
Family Nicotinic receptor ligand binding domain-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093PSE9
Sequence length 405
Comment (tr|A0A093PSE9|A0A093PSE9_9PASS) Gamma-aminobutyric acid receptor subunit beta-4 {ECO:0000313|EMBL:KFW77125.1} KW=Complete proteome; Reference proteome OX=328815 OS=Manacus vitellinus (golden-collared manakin). GN=N305_03789 OC=Coelurosauria; Aves; Neognathae; Passeriformes; Pipridae; Manacus.
Sequence
DYTITMYFQQSWRDKRLAYNDLPLNLTLDNRVADQLWLPDTYFLNDKKSFLHGVTVKNRM
IRLHPDGTVLYGLRITTTAACMMDLRRYPLDQQNCTLEIESYGYTVDDIVFFWQGNDSAV
TGMEVLELPQFTIIEQRLVSREVVFTTGSYLRLSLSFRIKRNIGYFILQTYMPSILITIL
SWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLA
LLEYAFVNYIFFGRGPRQQKKQSERISKANNERHRYEEKRVDPYGNILLSTLEMNNELLA
TDMMSSVGDSRNSVMSFEGSGIQFRKPLASRDGFGHHPTLDRHVPLSHHAAARNRANCRL
RRRSSKLKLKIPDLTDVSTIDKWSRIIFPITFGFFNLVYWLYYVN
Download sequence
Identical sequences A0A093PSE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]