SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093Q2F4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093Q2F4
Domain Number 1 Region: 19-67
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000649
Family Fibronectin type I module 0.07
Further Details:      
 
Domain Number 2 Region: 2-28
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000036
Family ATI-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093Q2F4
Sequence length 340
Comment (tr|A0A093Q2F4|A0A093Q2F4_9PASS) Mucin-5B {ECO:0000313|EMBL:KFW82831.1} KW=Complete proteome; Reference proteome OX=328815 OS=Manacus vitellinus (golden-collared manakin). GN=N305_01534 OC=Coelurosauria; Aves; Neognathae; Passeriformes; Pipridae; Manacus.
Sequence
TECVSGCMCPDGLVLDGSGGCIPKDQCPCVHGGHFYKPGETIKVDCNTCTCNKRQWNCTD
KPCKGTCTVYGNGHYMSFDGEKFDFLGDCDYILAQDFCPNNMDAGTFRIVIQNNACGKSR
SICSLKITLIFEVCLEWVITKEFEIRLLEGRIQEIATDPGAEKNYKVDLRGGYIVIETNQ
GMNFMWDQKTTVVVHVAPSFQGKVCGLCGDFDGRSRNDFTTRGQSMEMSIQEFGNSWKIT
STCSNINMTDLCADQPFKSALGQKHCSIIKSNIFEACHSKVNPIPYYESCVSDFCGCDSV
GDCECFCTSVAAYSRSCSRAGICINWRTPAICPVFCDYYN
Download sequence
Identical sequences A0A093Q2F4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]