SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093Q4X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093Q4X1
Domain Number 1 Region: 253-377
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-32
Family cAMP-binding domain 0.00000055
Further Details:      
 
Domain Number 2 Region: 120-238
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.32e-32
Family cAMP-binding domain 0.000000681
Further Details:      
 
Domain Number 3 Region: 14-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 3.92e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093Q4X1
Sequence length 386
Comment (tr|A0A093Q4X1|A0A093Q4X1_9PASS) cAMP-dependent protein kinase type I-alpha regulatory subunit {ECO:0000313|EMBL:KFW79257.1} KW=Complete proteome; Reference proteome OX=328815 OS=Manacus vitellinus (golden-collared manakin). GN=N305_07964 OC=Coelurosauria; Aves; Neognathae; Passeriformes; Pipridae; Manacus.
Sequence
MAASSSSSSEEERSLRECELYIQKHNIQQLLKDCIVQLCTVRPERPMGFIREYFERLEKE
ETKQLLNQLKSGSRSDSREDEISPPPPLNPVVKYRSRRGAISAEVYTEEDAASYVRKVIP
KDYKTMAALAKAIEKNVLFTHLDDNERSDIFDAMFPVTYIAGETVIQQGDEGDNFYVVDQ
GEMDVYVNSEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMAST
LQNLELKRNMYEKFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFII
LEGTAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRF
ERVLGPCSDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences A0A093Q4X1
XP_008920052.1.96775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]