SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093QNW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093QNW9
Domain Number 1 Region: 71-202
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.23e-45
Family Regulator of G-protein signaling, RGS 0.00000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093QNW9
Sequence length 210
Comment (tr|A0A093QNW9|A0A093QNW9_9PASS) Regulator of G-protein signaling 17 {ECO:0000313|EMBL:KFW85632.1} KW=Complete proteome; Reference proteome OX=328815 OS=Manacus vitellinus (golden-collared manakin). GN=N305_06986 OC=Coelurosauria; Aves; Neognathae; Passeriformes; Pipridae; Manacus.
Sequence
MRKRQQSQNEGTSAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEDRGDNAGRPTHTTK
LESIQVIEECQNPTADEILSWAQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDL
KKEQNKKVIEEKARLIYEDYISILSPKEVSLDSRVREVINRNLLDPSPHMYEDAQLQIYT
LMHRDSFPRFLNSQIYKSLVESITGSTSET
Download sequence
Identical sequences A0A091MHD5 A0A093QNW9 A0A218V6Y6 H0ZLQ3 U3KD48
XP_002187628.2.42559 XP_005043708.1.66865 XP_005043709.1.66865 XP_005420176.1.5688 XP_005488172.1.73095 XP_008927734.1.96775 XP_009079180.1.14518 XP_017677539.1.3805 XP_017933886.1.51550 XP_018775493.1.15306 XP_021396244.1.53032 XP_021396245.1.53032 XP_021396246.1.53032 59729.ENSTGUP00000011526 ENSTGUP00000011526 ENSFALP00000012952 ENSTGUP00000011526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]