SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093REX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093REX7
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 2.46e-31
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.00000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093REX7
Sequence length 103
Comment (tr|A0A093REX7|A0A093REX7_PHACA) Signal recognition particle 14 kDa protein {ECO:0000313|EMBL:KFW94567.1} KW=Complete proteome; Reference proteome OX=9209 OS=Phalacrocorax carbo (Great cormorant) (Pelecanus carbo). GN=N336_06509 OC=Phalacrocorax.
Sequence
QFLTELTRLFQKCRTSGSVFITLKKYDGRTKPVPRKGHVESFEPADNKCLLRATDGKKKI
STVVSSKEVNKFQMAYSNLLRANMDGLKKKDKKSKNKKSKATQ
Download sequence
Identical sequences A0A087RAH7 A0A091FI26 A0A091ITS1 A0A091KHS3 A0A091LG50 A0A091NWZ9 A0A091Q5K9 A0A091RVE3 A0A091VVF8 A0A093R1V1 A0A093REX7 A0A099ZSP0 A0A0A0ADS0 G1NHH3
ENSMGAP00000012629 ENSMGAP00000012629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]