SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093RHR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093RHR2
Domain Number 1 Region: 164-506
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-80
Family Protein kinases, catalytic subunit 0.000000513
Further Details:      
 
Domain Number 2 Region: 11-160
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.24e-44
Family Regulator of G-protein signaling, RGS 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093RHR2
Sequence length 531
Comment (tr|A0A093RHR2|A0A093RHR2_PYGAD) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=9238 OS=Pygoscelis adeliae (Adelie penguin). GN=AS28_13110 OC=Pygoscelis.
Sequence
KRSGRSKKWKEMLKLPPVSHCEGIRCSIERDYNQLCDKQPIGRLLFRQFCDSRPDLKRCI
EFLDAVAEYEVSSDEKRIDCGLKVLETYFTNGSAAHLPEIPQETVNECKARLEKNPSKDL
FMDCTRIVHEYLSRRPFEAYQDSVYFSRFLQWKWLEKQPVTKHTFRHYRVLGKGGFGEVC
ACQVRATGKMYACKKLEKKRIKKRKGESMALNEKRILEKVNSRFVVSLSYTYETKDALCL
VLTIMNGGDLKFHIYNMGNPGFDEERAIFYAAELCCGLEDLQKERIVYRDLKPENILLDD
CGHIRISDLGLAVQIPEGETVRGRVGTVGYMAPEVLKNEKYTFSPDWWGLGCLIYEMIEG
QSPFRKHKERVKRDEIDRRVKEDQETYSDKFSEEAKSICRMLLAKNPGERLGCTEDGAAI
VKQHPIFKNINFKRLEANMLEPPFLPDPRAVYCKDVLDIEQFSTVKGVNLDTTDDDFYSK
FVTGCVSIPWQNEMIETGCFEDINAYETDGTVSPDRERSPKPKRGFFHRLF
Download sequence
Identical sequences A0A093RHR2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]