SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093S729 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093S729
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily Lipocalins 4.22e-46
Family Fatty acid binding protein-like 0.00000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093S729
Sequence length 116
Comment (tr|A0A093S729|A0A093S729_9PASS) Myelin P2 protein {ECO:0000313|EMBL:KFW78664.1} KW=Complete proteome; Reference proteome OX=328815 OS=Manacus vitellinus (golden-collared manakin). GN=N305_04329 OC=Coelurosauria; Aves; Neognathae; Passeriformes; Pipridae; Manacus.
Sequence
MCNRFVGTWKLVSSENFDDYMKELGVGLATRKLGGLARPDVIISMKGDIITIRTESTFKN
TTISFKLGQQFDETTADDRKVKSVINLEKGSLVQVQKWNGKETTIKRRLVDGKMVV
Download sequence
Identical sequences A0A093S729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]