SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093SV84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093SV84
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily TRAF domain-like 1.26e-22
Family MATH domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093SV84
Sequence length 96
Comment (tr|A0A093SV84|A0A093SV84_9PASS) TNF receptor-associated factor 4 {ECO:0000313|EMBL:KFW86459.1} KW=Complete proteome; Reference proteome OX=328815 OS=Manacus vitellinus (golden-collared manakin). GN=N305_15112 OC=Coelurosauria; Aves; Neognathae; Passeriformes; Pipridae; Manacus.
Sequence
DNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFHPDPNWKNFQKPGASRSSLDESTLGF
GYPKFISHEDIRKRNYVRDNAIFIKASVEIPQKILA
Download sequence
Identical sequences A0A091ERQ4 A0A093SV84

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]