SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093TEZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093TEZ4
Domain Number 1 Region: 274-286,313-412
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000902
Family Pseudo ankyrin repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093TEZ4
Sequence length 1119
Comment (tr|A0A093TEZ4|A0A093TEZ4_PHACA) Transient receptor potential cation channel subfamily M member 5 {ECO:0000313|EMBL:KFW92944.1} KW=Complete proteome; Reference proteome OX=9209 OS=Phalacrocorax carbo (Great cormorant) (Pelecanus carbo). GN=N336_09812 OC=Phalacrocorax.
Sequence
MEEMDTKLCSSDKEEAFIRELPYCIGEIDFTASGKKRGKFIKVLSTIHPGTIFEVMRNKW
KLPAPNLVVSLEGEEENFQMKPWLRDTLKKGLIKAAQSTGAWILTSALRVGITRHLVQAV
QDRALASTSSKVRVIAIGITSLRKIQHREILDNTKNESLVHYQSDDNIQGPLYSLDHNHS
HFILVDHITPDEPDGTTKLRLTLEKHISEQRTGYGGTGSIEIPVLCLLVNGGPGTLERIC
SSLENSAPWLILPGSGGTADILATFMNDPQLITPEAVERQFKEKFPAESFLWKDILQWTA
TIQNIISHQHLLTLHNFEQDGSEELDTVILKALVKACKSHSQEAQEYLDELKLAVAWNRV
DIAKSEIFNGDVEWKSCDLEEVMMDALVNDKPEFVKLFIDNGANISEFLTYSRLQRLYCS
ISQKCLLYELLLRKHEESKLTLAGLTGQQHNEQKEICPLFTLNEVSRVLKDFLHDACKGF
YQELSHGGKKKSDKMNTKQLPGPLDMNQKSENPWRDLFVWAVLQNRHKMANYFWAMGQEG
VASALAACKILKEMSRLETETEVAHIMKEAKYEQLAVELFSECYHNSEERAFALLVRKNQ
YWSKTTCLQLATEADAKSFFAHDGVQAFLTKIWWGDISTSTQILKLICGFWCPFLIYTNL
IAFSEEKQSKNEPEPFRELDSLDTERTLFFSKEEDRGNGKSEKQNPSENTAWATFMLTRW
RKFWSAPVTVFMGNVIMYFAFLFLFTYVLLLDFKPPPPEGPSAKEIILYFWVFTLVLEEI
RQSFYTDEDTNLIKKIKLYVEDNWNKCDMVTIFLFIIGVTCRMLNSTFQTGRTILAIDFM
VFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLIAYGVTTQALLHPNDSRVE
WIFRRVLYRPYLQIFGQIPLDEIDTSRVYPRNCTFNPLQILQENSPSCPNSYANWLVILL
LVIFLLVTNVLLMNLLIAMFSYTFQVVQGNADIIWKIQRYNLIVEYHGRPALAPPFIIIN
HIALVLRRIFNKMEHKKEHLDLPVGLDQKIITWELVQKENYLVNLEQERKESSEERLKAT
SNKVENLSKYFSGFKEQEKRFKVMEAQIGYCTAVISSMA
Download sequence
Identical sequences A0A093TEZ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]