SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093TGE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093TGE4
Domain Number 1 Region: 16-82
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000643
Family Growth factor receptor domain 0.0046
Further Details:      
 
Domain Number 2 Region: 173-217
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000068
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 79-122
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000209
Family Fibronectin type I module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093TGE4
Sequence length 316
Comment (tr|A0A093TGE4|A0A093TGE4_PHACA) WNT1-inducible-signaling pathway protein 3 {ECO:0000313|EMBL:KFW93419.1} KW=Complete proteome; Reference proteome OX=9209 OS=Phalacrocorax carbo (Great cormorant) (Pelecanus carbo). GN=N336_05153 OC=Phalacrocorax.
Sequence
PSETSEVHQRKEVCHWPCRCPPVPSCTPGVSLVKDGCGCCKVCAKQSGETCNEADICDPH
KGLYCDYSEDEPRYETGVCAYLVAVGCELNGVYYLNGQTFQPNPLYKCLCVSGAIGCTPV
FTPKLAASPCTRATGRKRPGQSICGRGQHKQLPSTNYRLMSAYRSLPLVLKKKCLVQATP
WTPCSRTCGIGISSRVTNENRKCEMKKEKRLCFIQPCLTNILKTIKIPKGKTCQPTFQLP
TAEKLVFSGCSTTQSYKLTFCGVCLDKRCCIPNKSKMITVQFECPNEGFFKWKMMWITSC
VCQRMCGAPGDIFSEL
Download sequence
Identical sequences A0A093TGE4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]