SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093V2R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093V2R0
Domain Number 1 Region: 27-129
Classification Level Classification E-value
Superfamily Prefoldin 0.00000000000000131
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093V2R0
Sequence length 137
Comment (tr|A0A093V2R0|A0A093V2R0_TALMA) Prefoldin subunit 4 {ECO:0000256|PIRNR:PIRNR016477} KW=Complete proteome; Reference proteome OX=1077442 OS=Talaromyces marneffei PM1. GN=GQ26_0191740 OC=Eurotiomycetidae; Eurotiales; Trichocomaceae; Talaromyces.
Sequence
MLQHRMLSKDEEAAAGTEDTEVRREDQDKINRFSRLHQRETVLEERLKAKQKDKEDLEEV
SMELELADEDELVPYKIGDSFIHLPLEQAQSLLSTSTDEIDKEVSRLEDTLGEIREELSG
LKAALYARFGKAINLDV
Download sequence
Identical sequences A0A093V2R0 B6QAJ3
XP_002146836.1.75516 Pmar_ATCC_18224:PMAA_073650.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]