SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093VJX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093VJX2
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.2e-20
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00012
Further Details:      
 
Domain Number 2 Region: 78-167
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000857
Family Cold shock DNA-binding domain-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093VJX2
Sequence length 206
Comment (tr|A0A093VJX2|A0A093VJX2_TALMA) DNA-directed RNA polymerase II subunit rpb7 {ECO:0000313|EMBL:KFX52857.1} KW=Complete proteome; Reference proteome OX=1077442 OS=Talaromyces marneffei PM1. GN=GQ26_0022490 OC=Eurotiomycetidae; Eurotiales; Trichocomaceae; Talaromyces.
Sequence
MFFLKEETKVVTLHPSFFGPNVKEYLINRLNEEEEGRCTGDHFVICVMDMVDIGDGRVIP
GSGHAEYTIKYRAIIWKPFRGETVDAIVTSVKPTGIFTLAGPLSVFIARKNIPSDIKWEP
GTVPPQYTDHADQVIERGTSLRLKILGVKPDVSAINAIGTIKEDYLGESSPSALDDAEFL
PATALRRMAAYMPGSASVRQQVTSGW
Download sequence
Identical sequences A0A093VJX2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]