SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093VX37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A093VX37
Domain Number - Region: 5-45
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0336
Family Rubredoxin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093VX37
Sequence length 50
Comment (tr|A0A093VX37|A0A093VX37_CLOBO) Cytochrome C551 {ECO:0000313|EMBL:KON12396.1} KW=Complete proteome OX=1491 OS=Clostridium botulinum. GN=ACP50_10750 OC=Clostridium.
Sequence
MTDKTIVCRDCGSEFIFSVGEQEFYKEKGFDNEPTRCAACRRAKKEQNRR
Download sequence
Identical sequences A0A093VX37 B2TJT9 C5UVW3
WP_003373161.1.14250 WP_003373161.1.16164 WP_003373161.1.17341 WP_003373161.1.1917 WP_003373161.1.40399 WP_003373161.1.43682 WP_003373161.1.45387 WP_003373161.1.47997 WP_003373161.1.49945 WP_003373161.1.50906 WP_003373161.1.54004 WP_003373161.1.55913 WP_003373161.1.58365 WP_003373161.1.64077 WP_003373161.1.64452 WP_003373161.1.87966 WP_003373161.1.88993 WP_003373161.1.9385 WP_003373161.1.97908 gi|188587934|ref|YP_001922674.1| 508765.CLL_A1478 508767.CLH_3340 gi|187934132|ref|YP_001885672.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]