SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093XUN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093XUN6
Domain Number 1 Region: 381-446
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000022
Family Tachycitin 0.032
Further Details:      
 
Domain Number 2 Region: 182-247
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000214
Family Tachycitin 0.0092
Further Details:      
 
Domain Number 3 Region: 45-100
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000811
Family Tachycitin 0.042
Further Details:      
 
Domain Number 4 Region: 280-342
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000628
Family Tachycitin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093XUN6
Sequence length 450
Comment (tr|A0A093XUN6|A0A093XUN6_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFX90454.1} KW=Complete proteome; Reference proteome OX=1437433 OS=Pseudogymnoascus sp. VKM F-3557. GN=V490_06448 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MLLLSLLIAPLLIHLSSANSPNFRIEVKLRDTNPFKCPLDDIARTGCTGAKDCVYPHPQD
YTSYIKCIVDGPDGQQGTPTIQRCAPGLNWNQNTKECDALAKVMRSEGVNRCPGGSLWDN
DTEECTGLSNPTPSTDLHRCPSGFLWNNDSKDCERLRKSTRSVNDDGSHPAPFVCPVEEI
IESGCVAQNNCYFADLYSGCRAFHACVPASDGETYTPETYTCPPGLLFNKEIKSCDFPSK
VTCGSSQVGFPLGTAEDEKYNSDDVPHEFECPVEEIKASGCQPRNDCFFPDLYSSCRSFY
MCVLTPDGETYSHFQFTCPGDLLFDNDAKTCDFPGLIRCESTQAQASSSKLLTLDSGAPL
PETRKGGGQQQVLGAGFECPAKDGSHCPKKEDCKYPHPEDCEKYYVCEVNSDGWTRTAVL
GSCPREMWFSVETQECNSKDAVACNNAPGH
Download sequence
Identical sequences A0A093XUN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]