SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093Y9W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093Y9W9
Domain Number 1 Region: 142-221
Classification Level Classification E-value
Superfamily HMG-box 2.75e-18
Family HMG-box 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093Y9W9
Sequence length 251
Comment (tr|A0A093Y9W9|A0A093Y9W9_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFX95739.1} KW=Complete proteome; Reference proteome OX=1391699 OS=Pseudogymnoascus sp. VKM F-3808. GN=O988_05665 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MASTPPAPSDFDNLNDAAMFQIRSSVEFYFKSIHENMPAFYLPKEIVDSMGAERLARVAH
NYANEIQTDVTIAYDPAFHLFKIAPPEYMVSDEELTYLDTVVYQHGTIIPLRKWELMVPN
SSDRASNFGKSTLVEVGHGNRKITKPPNCFILYRRAHRHIVQERFPDATIGQISSITAQM
WAAEEKKVKLQYQQEAMKLKRQHDHDYPNWRCQPRKSSDIKKRAVKKCAPASSPVLVSMA
NSAPTPLETNI
Download sequence
Identical sequences A0A093Y9W9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]