SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093YHC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093YHC5
Domain Number 1 Region: 320-369
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000157
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093YHC5
Sequence length 513
Comment (tr|A0A093YHC5|A0A093YHC5_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY02163.1} KW=Complete proteome; Reference proteome OX=1437433 OS=Pseudogymnoascus sp. VKM F-3557. GN=V490_00593 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MDIRLDGYHVEQWFATDIRLAILRTRDQILTDDDLNAAFRSALGLVFMFVVCRKPESANQ
LLETLFKIEEFGFWGQYEAEKHSLELFWISFGGRPLNTPWNEWSPSLISELRNRPPRHPY
HHYSVQLWSNDLRSAPIPEDYDIHQWKDSQDWRIHSLCAKLLCKPAGGTYVPTRDNLEEA
FEALDKMFAVTPPGSEFGVLTQDIYTVRVYFVLALYFDHREKARDLMRIVMKTDGQPHVG
HLLDSPALYEFLAENDDLLIKSNDDAEMERAKHVISVALNSRAEQGIKLPLHDVPISELL
RRFSEAVFFTNNKDYLENGINKPEKILRPPLTEEEVAEVEEKLGEPLPPDLKELVLVADG
FKGGWHFAGGGWGGIKNSWKERASDHEIYLGYMPEPQLRTEMATRDDGSAYPVTTFTHNI
TVQGSTNDWGDVWGSDGVMENDGFLHLICPPTTWKKIQAAMGNEIEDGVYAYLNYAAWSG
GGKIYPSVRAMIAELTMKSERLAAVGLTESEGY
Download sequence
Identical sequences A0A093YHC5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]