SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093YIY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093YIY0
Domain Number 1 Region: 68-178
Classification Level Classification E-value
Superfamily FKBP-like 5.76e-28
Family FKBP immunophilin/proline isomerase 0.0000287
Further Details:      
 
Domain Number 2 Region: 2-37
Classification Level Classification E-value
Superfamily WW domain 0.0000000682
Family WW domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093YIY0
Sequence length 179
Comment (tr|A0A093YIY0|A0A093YIY0_9PEZI) Peptidyl-prolyl cis-trans isomerase {ECO:0000256|RuleBase:RU363014} KW=Complete proteome; Reference proteome OX=1437433 OS=Pseudogymnoascus sp. VKM F-3557. GN=V490_02060 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MSDAGLPAGWEVRHSTSKNLPYYFNASQQVSRWEPPQGTDTDKLKNYMARNHSASEIKPE
PSAANGNEGKIRAAHLLVKHKDSRRPSSWREADITRTKEEAMTIILAHEQRIRSGQTTLG
NLAVSESDCSSARKMGDLGYFGKGDMQKEFEDASFNLKPGEISHVVETASGLHLIERIE
Download sequence
Identical sequences A0A093YIY0 A0A094DJI2 A0A094F862 A0A094H384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]