SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094AM81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094AM81
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.83e-22
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0014
Further Details:      
 
Domain Number 2 Region: 79-195
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000565
Family Cold shock DNA-binding domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094AM81
Sequence length 207
Comment (tr|A0A094AM81|A0A094AM81_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY30721.1} KW=Complete proteome; Reference proteome OX=1420907 OS=Pseudogymnoascus sp. VKM F-4513 (FW-928). GN=V494_08066 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MFILTKISDLVQITPEDFSKPSKQAIEDNINAKYANKVIQKIGLCICLYDLLTSSEGLIG
HGTGLVNVNVEFRLVVFRPFRHEVLHGRITSASPEGIHLRTTFFSDIFVPASSLPAGTFF
DHSQGVFIYRHPHIPDLMHFDTYEMARFRIEEEEWIDQTPEKPESDTAMDEEERRARRLS
PWRIVASMADDGLGPCFWWDEDEEPEE
Download sequence
Identical sequences A0A093Z9M8 A0A094AM81

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]