SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094AUI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094AUI0
Domain Number 1 Region: 40-194
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 5.1e-23
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00029
Further Details:      
 
Domain Number 2 Region: 332-342,393-451,489-540
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000745
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094AUI0
Sequence length 639
Comment (tr|A0A094AUI0|A0A094AUI0_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY26780.1} KW=Complete proteome; Reference proteome OX=1420901 OS=Pseudogymnoascus sp. VKM F-3775. GN=V491_01168 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MDMHPLDSQFDNLGISSVPQEPFLPRPSRSFDSKATDCQKLHVLVAANCERDVSKAEALL
VRFFGHAKVECRAICDDPTAKAIRFAPTLENSSSSVGRGLNNGEGTAHVWAEWADLLVLA
PVNADTMGKMLNGITGTLILDVLRGWDVSKKIILVPGMTTSMWENPMTKKQLSKLRRKWN
WVRVMPPILWQYDEKGAKKCLIQYDGFSDLVETINNQAELLTIGHDVDITTSGDIEQARR
NQKTETRLPSELWTIIFDYVGDWEVAQSIGIYTNLLIPKEWEHRESPKDELHEYIRSLES
TILTKPVPHVIEKLGQAPKSMEYLSSLCVKLIIKFCLTDVLSYLETKFREVFWTSFGGKL
LPTKASAVYGRNEILEWWRTSASFLKKDYTDEAIDGASKSGFVHVLDWWKKSGLPLKYSE
AALEQASSKGHILVLEWWKEASMHQGAYILEPESKNPSSRRTNSSYLYEPASPSFDSQSM
DIGFAPLRLKVGKSVLYAAQNGQTRVVHWWDTSGIPYSHSDSVARVASTYGHVDVLEVWK
SLKGSKFAMSYDNQVLVGPTKNGFVRVLEWWRRQTSGEDWGWEGKRLKVEYKTCDIEEAL
EDSVRLAGGEGEDEVRKWWARNGLNLGVGTSEWMEIKTL
Download sequence
Identical sequences A0A094AUI0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]