SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094BQY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094BQY1
Domain Number 1 Region: 866-995
Classification Level Classification E-value
Superfamily PX domain 4.45e-24
Family PX domain 0.00093
Further Details:      
 
Domain Number 2 Region: 417-564
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.86e-18
Family Regulator of G-protein signaling, RGS 0.0061
Further Details:      
 
Domain Number 3 Region: 1546-1627
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000149
Family Canonical RBD 0.002
Further Details:      
 
Domain Number 4 Region: 1350-1456
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000013
Family Canonical RBD 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094BQY1
Sequence length 1646
Comment (tr|A0A094BQY1|A0A094BQY1_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY37705.1} KW=Complete proteome; Reference proteome OX=1420907 OS=Pseudogymnoascus sp. VKM F-4513 (FW-928). GN=V494_04639 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MALSRRDVILAGIAIFFAWGGVTSLIPSLRWTAWAFVAGILVAVLGLATIVLTTTRGSSY
GSRSRIVRPRGPDFLGAEAWREELANLQSRQPYSPRPLYPDSFLISASLDELLEYVVRDF
VKTWYSNISRNPSFTNEVDKGIRDALTDIRDRLLSTDLVEVVIERFVPILTAHFKDFYDA
ERVVRGKHLNRNVTESEELDLAIAAKYRDGKLHPAASLAYSDTRLVQQEHLRTLAKEIIP
KVVPESLISSKVVTVLIEELVSCAVLFPVMQLASDPDTWNQVMENYGRSMLQDRSTVRKL
RKALDQHASPAPKEKRSLPFPRLSPHDNERKFEKFIRAARKVNNLSDARRFRSEVSSQLK
RDSQDETVDSVYLRRLEIAKKILDQRVNHLASGNWSANGNDAPRRSSNNGPTSDLNNASL
VDILHDSSALSYFMEYMDRQKVMPLVQFWIVVDGFRNPLEEDPTEDDEVPPNLPPWTDAD
RLDLAQIHEAYLSRPELNISESSKQSVRTFLKAGKGASQEQYYAARRTILLAQTSALEKM
KGKYFDGFKKSDLFYKYLTSQEASKNTKASLSQNPFDDQDRPALPPRHDTAQSLPPKPKA
VPRISLRQPQRKIAIHRTSQSSADLPSMARRNVMDLANSRRSLDGDGDSPLFDDEDADSD
ALAGSVQSLDQGGDHNDGPTAPDNHIVKAMEAALNDIMEDTPNVDDLRGSLFDNGDSPAN
SLLFGKPEGSPRNSIDVLSTDSLHKEGGRPNIASLGLVNTSSRIGVFTDDDLFGDEEKFL
SDEHDDPDDDKEDVTDQIHEAAPGDLGLAEAITVLTTDIERLIAQNAVVESLTRKAELTN
NTAELRILRKSKASLQREIRRKELQRQQYVVQESDNSLYGRSTIRIKSIMVGKDDDGREF
AIYVVEVQRMAGEQMIAASWAVTRRYSEFLELHQKLREKYPSVRHLDFPRRRMVMKLQSD
FLHKRRLALEKYLRELLLLPDVCRSRDLRSFLSQSAIAPGTDAPSNLEDKQDMMTRFYNS
VTDGMEDILGNIPVLDQLSTAGQNLISAAANQLTTMPPLVSEDPMTAAEAEAELNAFENR
ELEPFVKPICDIFLEVFELNRGNNWLRGRAVVVVLHQLLGGTIERKVRENVKTLVLEDSI
MRYITLLKDTMWPGGKKRVMVPRTPAEKAKTRTEASLMLATLIPDLVGNVVGRVNAQAAS
RRIFATLNNPRLNSHLMFTFLDEIVDVLFGGSRSLTVTFQDIPPPSSKQIHARDPLYQVL
AMDSQSPINHGLSSFPIDPQTFDADDRISYSKLDRKFLLVADDGSEYEFDDALRRWIPVL
DDELARQQQAAYKVQGVDEEETVEDMRRKRKKEYVNGEDDNGGRAVKAPKKAKAPLPPRP
NTAVYVTGLPRDVTIDEVAEVFSRKCGVIAEEIDSGRPRIKLYTDDSGAFKGDALIVFFK
APSVNMAITLLDDTDFRYSDLGGSGKMRVMAADSSYKKTKAEEGSGGASTADKEAARERA
KTSARDKAKIIKKTQKLDARLADWDDDDPQVLYEAGPKPQKLVVLKHMFTLEELAEDPAA
ILDIKEDIREECAKLGEVTNVVLFDLEEAGVASVRFRDEAAATECVRVMNGRSFAGQTVE
AYLSEGKEGFKKSKAKAQEGEEGVEA
Download sequence
Identical sequences A0A094BQY1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]