SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094CDD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094CDD6
Domain Number 1 Region: 515-671
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.11e-27
Family Regulator of G-protein signaling, RGS 0.0011
Further Details:      
 
Domain Number 2 Region: 376-491
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.88e-18
Family DEP domain 0.024
Further Details:      
 
Domain Number 3 Region: 200-325
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000158
Family PadR-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094CDD6
Sequence length 697
Comment (tr|A0A094CDD6|A0A094CDD6_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY52196.1} KW=Complete proteome; Reference proteome OX=1420910 OS=Pseudogymnoascus sp. VKM F-4516 (FW-969). GN=V497_08603 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MALTKSSHPEHHLPTLSRSDFPEQPQFFEESPTSLATSSLSDSQSSPEKNPSIDTLLRVR
SNSKQRQSTLSTTSSRSSRTNLLTFAALARDKTTSAIANFSDPVTRAQVSRKNSHNRRAG
DSEKSPERKSDPSRSISPQSKESQPVTPRLGLQDTEPPSQSYEDTDANTPTPRKVGAPEQ
STMHQTSSRLLRMTEDDRPFTRDFKDLFATLIVSLPLESHRRMFNKCEHSFLSEEAINNL
GSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMARDMARTVCQRFVDARFIESADGKQIREF
NLKGTLWQLTPKGIHVLDRFCSKNGIQQRHVVDLVNSPKNTMQLVVLERDSITDEISQDR
GTVEVLFRRFIGANGPNIKSSVSAADSDSLSEYKDGLAGVRMAGERKIGSPQRTVLQSFT
GKAAVDWLLDCCTTVDKNETMKIAALFLEHDLIWCVLSDRSYTSQFPQHKFQPTKVAIYQ
MTQKGKDVINMSSTHRLSNGDVESPSSRVGVSRDSNTQKLDKILTDAALRLLFREQLRDT
HCEENLSFYLDVDEFLKSCTDALQGMSPAARAKNPDRSLDAIKETMASAYGIYNAFLAPG
SPCELNIDHLLRSQLASRMTKAVGRDDAMIDSLKEVIKLFEEAQLSVFKLMASDSVPKFM
KSAKYEQTLKNYDFDSIPAHPAPGQARTHGSVNRSSR
Download sequence
Identical sequences A0A094CDD6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]