SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094CWK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094CWK3
Domain Number 1 Region: 1-39
Classification Level Classification E-value
Superfamily SAP domain 0.00000000183
Family SAP domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094CWK3
Sequence length 276
Comment (tr|A0A094CWK3|A0A094CWK3_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY58374.1} KW=Complete proteome; Reference proteome OX=1420910 OS=Pseudogymnoascus sp. VKM F-4516 (FW-969). GN=V497_04870 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MADYNSLKVPDLKKILTERALPLSGNKADLIARLQEDDKKKAPVSAAPAAADDEIDWDED
DSKVAPGAATTTAAATTIAAGGQGPIETPLAVPNQKQDVDPAATTDLKVTGGADAPAAAD
GAVAANGEVEAVVVEEPKQDFSIGLQKTDAEKEAEKRAARAKKFGIVPDDEEVKRAERAK
KFGGGAGDVDVSGLDGALPERKKRGREEREGKPVGRDAKRQTPDRRAEPAKKEARPSVPK
QEPKKAYKSVLDDPVEKAKAEARRQKFASAPAPAST
Download sequence
Identical sequences A0A094CWK3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]