SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094CYU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094CYU0
Domain Number 1 Region: 242-304
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000558
Family Heme-binding PAS domain 0.063
Further Details:      
 
Domain Number 2 Region: 310-365
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000112
Family Homodimeric domain of signal transducing histidine kinase 0.006
Further Details:      
 
Domain Number 3 Region: 334-443
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000236
Family Histidine kinase 0.015
Further Details:      
 
Domain Number 4 Region: 18-72
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000844
Family Regulator of G-protein signaling, RGS 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094CYU0
Sequence length 453
Comment (tr|A0A094CYU0|A0A094CYU0_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY57138.1} KW=Complete proteome; Reference proteome OX=1420909 OS=Pseudogymnoascus sp. VKM F-4515 (FW-2607). GN=V496_06528 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MPSGNHLPSRPLSVAIPAKQYCPRRPTLREVLANSAPPPWTLSAFTVYLSQNHCLETLEF
TMDATLYRKHYEMLLANCGEKTICPRPKGANTPWLHLTPECDGQTFNSAHSHQLVQPSDL
ALALKYGVKFIHPSPSSSCAEANNDSFIEHSMSAESSSSLGEHERIEFKGLRKSRAGHPV
GANIRSGALIPRKRTIHELQRRREQSARDRRRPIGFLGDENNPASWLEGISGGNIQAQFR
DKNTNEMYRILVNNVKDYAIFMLDMQGHITTWNAGASILKQYEPEEIIGQHFSIFYGDED
LAAKKPQKDHEMRTPMHGMMGASSLLMESDLTNEQNELAQIIEELGKILSQVINDILDYS
NLASGFLTVTATISVPDIISAVVRAAQVTLPPSFVLEAEAMRAFPKNVESDPFRFRQVLQ
NIVSNAVKITEQGSIRIITKISAEDDTSYTLLT
Download sequence
Identical sequences A0A094CYU0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]