SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094D8V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094D8V0
Domain Number 1 Region: 142-229,288-355
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.73e-18
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094D8V0
Sequence length 546
Comment (tr|A0A094D8V0|A0A094D8V0_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY55880.1} KW=Complete proteome; Reference proteome OX=1420910 OS=Pseudogymnoascus sp. VKM F-4516 (FW-969). GN=V497_06634 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MASLGFGKVFRSAWHSLTSYDRHSEFDSPYRTGQHVPLAQSRHDPLTSVATDGSESRADI
SSPYLDDQASSASALNGNAFPPSPAYARNPGNTSPSPYSPGMRSSSAQKQNDNFPENTSP
GEIQMQAFQEGLPPPPPVAHSWRRMDKWAEENYEELFEELGEGCTSNDLNDLEHQLDCSL
PMDVRESLQIHDGQEVGGRPTGMIFGCMLLDCEEIVHEWRNWKTVNEQYLNAPSTYTPST
PATALGGSSTASTSKKPQQPQNPMWRQDLLAKQDSQPPGAIQRVYAHPRWIPLARDWGGN
NLAVDLAPGPTGKWGQVILFGRDYDCKYVVSRSWATFLATVADDMNSGKWFIDEDTNELK
LREFKTSHVEPAYLDILRWRSDQKYGRRGPRRRPQNGSAKGAGSPTGSPYDSPVAEMGEP
RGRSMQRFSGASPVSSPNRPNYPKSSPLSKVAEEIPSAQVASPLQGVVNTEVPSSSKPLV
EIGTPRGSDEEKRAKAMESLLDPPVTKDDKENVKADSTPAVDSKLNGNATKQATVEDDNV
MKTIEI
Download sequence
Identical sequences A0A094D8V0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]