SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094DU20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094DU20
Domain Number 1 Region: 9-114
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 5.75e-24
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094DU20
Sequence length 137
Comment (tr|A0A094DU20|A0A094DU20_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY62950.1} KW=Complete proteome; Reference proteome OX=1420910 OS=Pseudogymnoascus sp. VKM F-4516 (FW-969). GN=V497_02136 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MLITMAPPLTNDEFFTKLSELFDKNRSESQGSVFLTQKRLTYSAPSDTFPTEADAPSFTD
LEPTQPLSLLIRATDGKHKSKVRLSTVVTADSLEGFFGRYAEVCKAGMSGLKKRDRSKAK
ARQKAKKKVVPTGEEKK
Download sequence
Identical sequences A0A094DU20

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]