SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094EAU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094EAU8
Domain Number 1 Region: 323-377,441-498
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000017
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094EAU8
Sequence length 509
Comment (tr|A0A094EAU8|A0A094EAU8_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY73583.1} KW=Complete proteome; Reference proteome OX=1420912 OS=Pseudogymnoascus sp. VKM F-103. GN=V499_06343 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MAIRKEVRSVLRWTCDQICASDLIAFPLDYNSPTCYDPQPAELIIRFVDDLIVSCKPDAA
NAILGKLFQVPEFCNMPQGERTFEFFWSYFLGRPTNTPWPQWDEKRLAEEKRLSDPENVR
FYDGWSDASWITETQGIAIGDDYDVHQWKDSSDCWTQSICAHLLCQPKDGRPPSRETLQE
AFEALEKLSTMTLPAGYGNIFNDRSYFIITMYLGHFQRACEIFQQIGIYRFGDEFFCNPA
FYQLLMTFMSDPPIKRYNAEEAKEIVQQVCTALDTKLERPSGVSIHKEPIESPVSDLLQR
LSIAAFSVYHGDYLAAGINSPADILLPAITAERITEIEQHLGAPLPPDVKEIAMVANGFY
GGWNFAGGGWSGISKNVSVCPADDCAMWMGDDGEDDFQSTQTNETRTRDDGSTYEELVDT
QYDDETELGNVYVSSAPADCDGYIHFMCPPETWRTFQKARRGIKSPDGEYAVFYHAPWQD
SSDVHIFKSLTEWLTNVMLSIETEAEASE
Download sequence
Identical sequences A0A094EAU8 A0A1B8GGJ9
XP_018128691.1.55463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]