SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094EDT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094EDT9
Domain Number 1 Region: 1-145,185-231
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 4.55e-38
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094EDT9
Sequence length 278
Comment (tr|A0A094EDT9|A0A094EDT9_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY76826.1} KW=Complete proteome; Reference proteome OX=1420911 OS=Pseudogymnoascus sp. VKM F-4517 (FW-2822). GN=V498_09491 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MILFVKHWAKRRAINTPYRGTLSSYGYVLMVLHYLVNIAQPPVAPNLQHHNPPPHAPTVA
PQTCQGANVTFWRDERELTDLARRGLLNHNGESVGALLRGFFEYYAQNGPMSSGGGRGFD
WGREVLSLRTRGGLLTKQEKGWVGARTVTQTTTEAAPAATTAASGNGTGAPGSPGAARKV
VRKEEVKEIRHRYLFALEDPFELEHNVARTVTHNGIVAIRDEFRRALRVVRGVGRGGKEA
EGLLDEVKTEEGGKEGLVEAMKVIHGLGEEFGGGTAEA
Download sequence
Identical sequences A0A094EDT9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]