SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094EEE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094EEE0
Domain Number 1 Region: 194-529
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.03e-68
Family Ankyrin repeat 0.0000148
Further Details:      
 
Domain Number 2 Region: 491-603
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000288
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094EEE0
Sequence length 617
Comment (tr|A0A094EEE0|A0A094EEE0_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY77056.1} KW=Complete proteome; Reference proteome OX=1420912 OS=Pseudogymnoascus sp. VKM F-103. GN=V499_03461 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MDDQLPPPPYSVHNPHDTSSQILADSVGLVPQESNDLSASSIGANSHFASRPPDQTPPSR
IISHRIVLEPDSSRDEIELPPLFSERGVDEQDWFTFCNHLFPDHVLAGNNQKGGTSYELD
EKQPLYPSSKNANGLGNLGLSNSTTGPKDGDSEKDYVRRSNIHKVVKEWNSGFFEPRGLL
VIAKTSVPLSSKLGDLNSRSIFGGTIIAKAAARGDFKVVEGLLLQGADPDSSALYDAAAN
RHPSVVNLLIQHGAKVDTKPSTTHLVASQGNARTLATLLKYGANPNHKNWTGNSPLFDAA
GRGDIPVLKLLLAYGANPNYANTGGHSALYYAIQRRDTTVIQLLLDYEADPNYRPWTGQP
CVHLAAAQGDMNTVQALISKGADINATPTMGETALGSAIYRDNLEMVHLLLDNGADVNIK
PLTGQSPLFLVASRGEVVLLRLLLEKGANLDESPPGFPSALYMAIHREDLETAKVLLEFG
ANASTGNSLNVAVDHSNVNAVKLLLDHGADPNSKPPGGQTPLYSSAAKGDTVSMELLLKK
GAKVDWTPAGFPTALYMAVAREDPKVARILLSYGADVNATVAGFGTVLDRVMKSGSEEIR
QLLSLDKSNYYPFDKEG
Download sequence
Identical sequences A0A094EEE0 A0A1B8GB63
XP_018126809.1.55463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]