SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094EI73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094EI73
Domain Number 1 Region: 49-93,202-273
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000275
Family Regulator of G-protein signaling, RGS 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094EI73
Sequence length 438
Comment (tr|A0A094EI73|A0A094EI73_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY71335.1} KW=Complete proteome; Reference proteome OX=1420912 OS=Pseudogymnoascus sp. VKM F-103. GN=V499_08469 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MVYSLAYRRPAYVEPEIYASRQPGSETEGKEESVRSGRSGKNAGIPAALAFDKIVEGGTC
APCTLRDFMDYMLYVEHSAENLKFYLWLNDYTERFNNLTESSKMLSPQYIYVSPERNSPV
TMPLPAVPKRQSFANEVFKGTVFDNDPFRTPRSSDSDLTDRPAGFSLPWSNVRIPGRKSP
SPTKPNRTLAISAFAENGMRPPFSTQPFRAEICRVISTYLLPSSPHELNLSSRDRATLLA
ALERTTHPSAFIRARAAIDDSLRNQSHPNFIRWAIANGNPPRISFAWWGGIALLFLGTLV
AMLLTLSRAPRGYRILAAIPWVFGASTFGMAREGLCVCLHAMRARQVRPWELFGDSEAEV
EMGKAELDGMSITTSGLSVMMGAGEAPWGCGAGGEGGAEYVVCAGVVGGGAGDGGGDGGV
CGDAEWEFLLSVLLMVFG
Download sequence
Identical sequences A0A094EI73

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]