SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094EIA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094EIA3
Domain Number 1 Region: 68-136
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000157
Family SNARE fusion complex 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094EIA3
Sequence length 167
Comment (tr|A0A094EIA3|A0A094EIA3_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY46842.1} KW=Complete proteome; Reference proteome OX=1420907 OS=Pseudogymnoascus sp. VKM F-4513 (FW-928). GN=V494_00298 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MASRFGPSSLHQRDPRSALFEGYDGGGAGRARNGNNGSPRNDGGYGYSGGGGLGPERQAY
RPATPNSRGQYSDATLNELESQNDGEVEGILGKVKQLKDMTIAIGDEIRESSALAEKMND
SFDNTRVRLRGTMNRMLLMAEKTGVGWRVWVGFFAAVMLLFIYVWLF
Download sequence
Identical sequences A0A093Z3J1 A0A094EIA3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]