SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094EMF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094EMF7
Domain Number 1 Region: 17-160
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.94e-22
Family Regulator of G-protein signaling, RGS 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094EMF7
Sequence length 316
Comment (tr|A0A094EMF7|A0A094EMF7_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY79881.1} KW=Complete proteome; Reference proteome OX=1420912 OS=Pseudogymnoascus sp. VKM F-103. GN=V499_01186 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MPPKKHLPSRPLSLAIPVKRYSPRRPTLQEILANSAPPPWTLSAFTAYLSQNHCLENLEF
TMDATLYRKQYEALLANCGEETIMASTEGCEYVRMLWQKLLDAYITPNGPREVNIPGDVR
DRLLSSPNHFRPPSPLQLDSAIMVVYELMDESVLVSFLNSVSRGFSNYTGPWTSVEDTSV
IPTPDSPPMPPAASTRIGYGSTSSSGPSRDAQTSNSAHSHQPVQRSHLAAALKRGVKFIY
PSPSSNSAKENNDSLIKYTISAGSSSSLGEFMIPLIIPPTYNSFTDTSESSSKVSRAGES
DSKKMGWKLGLGLRKP
Download sequence
Identical sequences A0A094EMF7 A0A1B8GBK9
XP_018126900.1.55463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]