SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094EPG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094EPG3
Domain Number 1 Region: 518-674
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.14e-27
Family Regulator of G-protein signaling, RGS 0.0011
Further Details:      
 
Domain Number 2 Region: 379-494
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.07e-17
Family DEP domain 0.022
Further Details:      
 
Domain Number 3 Region: 203-328
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000158
Family PadR-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094EPG3
Sequence length 700
Comment (tr|A0A094EPG3|A0A094EPG3_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY73570.1} KW=Complete proteome; Reference proteome OX=1420912 OS=Pseudogymnoascus sp. VKM F-103. GN=V499_06330 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MALTKSSHPEHHLSTLSRSDFPEQPQFFQDSVDSLATSSLTDSQPSPEKNPSIDTLLRVR
SNSKQRQSTLSTTSSRSSRTNLLTFAALARDKTTSAIANFSDPVTRAQVSRKNSHNRRTA
GDSEKSPERKSDSSRSIPPQAKESQSIIATPRPGLQDTEPPSQSYEDTDANTPTPRKVGA
PEQSTMHQTSSRLLRMTEDDRPFTRDFKDLFATLIVSLPLESHRRMFNKCEHSFLSEEAI
NNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMARDMARTVCQRFVDARFIESADGKQI
REFNLKGTLWQLTPKGIHVLDRFCSKNGIQQRHVVDLVNSPKNTMQLVVLERDSVTDEIS
QDRGTVEVLFRRFIGANGPNIKSSVSAADSDSLSEYKDGLAGVRMAGERKIGSPQRTVLQ
SFTGKAAVDWLLDCCTTVDKNETMKIAALFLEHDLLWCVLSDRSYTSQFPGHKFQPTKIA
IYQMTQKGKDVINMSSTHRLSNGDVDSPSSRVGVSRDSNTQKLDKILTDAALRLLFREQL
RDTHCEENLSFYLDVDEFLKSCTDALQGMSPSSRAKNPDKSLDAIKETMASAYGIYNAFL
APGSPCELNIDHLLRSQLASRMTKAVGRDDAMIESLKEVIKLFEEAQLSVFKLMASDSVP
KFMKSAKYEQTLKNYDFDSIPAHPAPGQPRSHGSVNRSSR
Download sequence
Identical sequences A0A094EPG3 A0A1B8GGM1
XP_018128704.1.55463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]