SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094F693 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094F693
Domain Number 1 Region: 109-303
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.18e-58
Family CRAL/TRIO domain 0.000000252
Further Details:      
 
Domain Number 2 Region: 15-103
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 7.98e-22
Family CRAL/TRIO N-terminal domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094F693
Sequence length 354
Comment (tr|A0A094F693|A0A094F693_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY54937.1} KW=Complete proteome; Reference proteome OX=1420909 OS=Pseudogymnoascus sp. VKM F-4515 (FW-2607). GN=V496_07131 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MAAPAPAEVVPLKTDPKYDDYDFPTVSATNQSGHAGHLTPEQEAQVHQLRMSLEQTGFTE
RLDTLTLLRFLRARKFDVALSEAMFVNSEAWRKEINLDDLVQNFEYTEKAQIFEYYPQYY
HKTDKDGRPVYIEQLGKCDLTAMNKITTQERMLQNLAVEYEKVSDPRLPACSRKSGHLLE
TCCTIMDLKGVGISKISSVYGYVKEASAMSQNHYPERLGRLYLINAPWGFSSVFGMIKSF
LDPVTVEKIHVLGSGYQAELLAQVPAENLPKQFGGQCDCPGGCGFSDAGPWSEPEFYRPP
KWAKKEGEKKKEDDAIDNTEGKGETVTAAPIPEAGGVAAEVPAKAYTDHGIAPA
Download sequence
Identical sequences A0A094F693 A0A094FCR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]