SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094F7J3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094F7J3
Domain Number 1 Region: 142-229,289-356
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.36e-17
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094F7J3
Sequence length 547
Comment (tr|A0A094F7J3|A0A094F7J3_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY86946.1} KW=Complete proteome; Reference proteome OX=1420913 OS=Pseudogymnoascus sp. VKM F-4518 (FW-2643). GN=V500_07296 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MASLGFGKVFRSAWHSLTSYDRHSDFDSPYRTGQHVPLAQSRHDPLTSVATDGSESRADI
SSPYLDDQASSVSALNGNAFPPSPAYARNPGNTSPSPYSPGMRSSSAQKQNDNFAENSSP
GEIQMQAFQEGLPPPPPVAHSWRRMDKWAEEHYEELFEELGEGCTSNDLNDLEHQLDCSL
PMDVRESLQFHDGQEVGGRPTGMIFGCMLLDCEEIVHEWRNWKTVNEEYLNSPSTYKPST
PATALGGSSSASSSSRKPQQPQNPMWRQDLLAKQDSQPPGAIQKVYAHPRWIPLARDWGG
NNLAVDLAPGPTGKWGQVILFGRDYDCKYVVSRSWASFLATVADDLNSGKWFIDEDTNEL
KLREFKTSHVEPGYLDILRWRSDQKYGRRGPRRRPQNGSAKGAGSPTGSPYDSPVAEMGE
PRGRSMQRFSGASPVSSPNRPNYPKSSPLSKVAEEIPSAQVASPLQGVVNTDLPNASKPL
VEIATPRGSDEEKRLKAMESLLDPPTTKDDKENVKADSTSAGDSKLNGNATKQATVEDDN
VMKTIEI
Download sequence
Identical sequences A0A094F7J3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]